Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITX2 Peptide - N-terminal region

PITX2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARP1, Brx1, IDG2, IGDS, IGDS2, IHG2, IRID2, MGC111022, MGC20144, Otlx2, PTX2, RGS, RIEG, RIEG1, RS

UniProt

Q99697

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PITX2 Rabbit Polyclonal Antibody (orb576481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000316

Preservative

Lyophilized powder

AA Sequence

EHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NOTCH2 Protein, C-Fc
bs-103058P-01 20 µg

Recombinant Human NOTCH2 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human NOTCH2 Protein, C-Fc
bs-103058P-02 50 µg

Recombinant Human NOTCH2 Protein, C-Fc

Sign In for Pricing
View Details
ChAT Protein Lysate (Mouse) with C-HA Tag
16018034 100 µg

ChAT Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Mouse Monoclonal Mouse anti-Human IgM Heavy Chain Secondary Antibody (47.2.E9) [Janelia Fluor 646]
NBP2-68319JF646 0.2 mL

Mouse Monoclonal Mouse anti-Human IgM Heavy Chain Secondary Antibody (47.2.E9) [Janelia Fluor 646]

Sign In for Pricing
View Details
Lentiviral mouse Cntnap4 shRNA (UAS) - Lentiviral mouse Cntnap4 shRNA (UAS) (25)
GTR15254009 1 Vial

Lentiviral mouse Cntnap4 shRNA (UAS) - Lentiviral mouse Cntnap4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human/Mouse ATN1 Affinity Purified Polyclonal Ab
AF6567 100 µg

Human/Mouse ATN1 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details