Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITX2 Peptide - N-terminal region

PITX2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARP1, Brx1, IDG2, IGDS, IGDS2, IHG2, IRID2, MGC111022, MGC20144, Otlx2, PTX2, RGS, RIEG, RIEG1, RS

UniProt

Q99697

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PITX2 Rabbit Polyclonal Antibody (orb576481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000316

Preservative

Lyophilized powder

AA Sequence

EHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Human CEACAM5 (C-6His-Avi)
32-11408-100 100 µg

Biotinylated Human CEACAM5 (C-6His-Avi)

Sign In for Pricing
View Details
Canine IL-10 MAb (Clone 138111)
MAB7351 500 µg

Canine IL-10 MAb (Clone 138111)

Sign In for Pricing
View Details
Olr245 AAV Vector (Rat) (CMV)
34255106 1 µg

Olr245 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
SLC25A43 siRNA (Human)
orb1851917-01 15 nmol

SLC25A43 siRNA (Human)

Sign In for Pricing
View Details
SLC25A43 siRNA (Human)
orb1851917-02 30 nmol

SLC25A43 siRNA (Human)

Sign In for Pricing
View Details
FOXI1 shRNA (m) Lentiviral Particles
sc-75053-V 200 µL

FOXI1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details