What is the catalog number for Pkib Peptide - middle region?

The catalog number for Pkib Peptide - middle region is orb2009514.

What sizes are available for Pkib Peptide - middle region?

Pkib Peptide - middle region is available in the following size(s): 100 µg.

Is Pkib Peptide - middle region in stock?

Pkib Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Pkib Peptide - middle region

Product Specifications

Product Name Alternative

PKINH, Prkacn2, RATPKINH, Pkib

UniProt

Q8R4R3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001070021

Preservative

Lyophilized powder

AA Sequence

TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-74949B 0.1 mL

Mouse Monoclonal ZNF394 Antibody (OTI1G9) [Biotin]

Sign In for Pricing

View Details

PB9775-Fluoro594 100 µg/Vial

Anti-PGRMC1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing

View Details

PC500831 1 Each

2- (2,2,2-Trifluoroethoxy) benzaldehyde

Sign In for Pricing

View Details

NBP2-99894AF350 0.1 mL

Rabbit Polyclonal KIR2DL1/CD158a Antibody [Alexa Fluor 350]

Sign In for Pricing

View Details

TU112575 1.0 mL

Lrp1b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing

View Details

26320012 1.0 µg DNA

LASS2 ORF Vector (Human) (pORF)

Sign In for Pricing

View Details