Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pkib Peptide - middle region

Pkib Peptide - middle region

Product Specifications

Product Name Alternative

PKINH, Prkacn2, RATPKINH, Pkib

UniProt

Q8R4R3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001070021

Preservative

Lyophilized powder

AA Sequence

TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta I Tubulin
520578-01 100 µL

Beta I Tubulin

Sign In for Pricing
View Details
Beta I Tubulin
520578-02 200 µL

Beta I Tubulin

Sign In for Pricing
View Details
Kcnma1 (NM_001253358) Mouse Untagged Clone
MC229526 10 µg

Kcnma1 (NM_001253358) Mouse Untagged Clone

Sign In for Pricing
View Details
Box of 100 discs of standard filter 64g/m², 330 mm
ST60A0330 Box of 100

Box of 100 discs of standard filter 64g/m², 330 mm

Sign In for Pricing
View Details
SOD1 siRNA (Rat)
orb1833620-01 15 nmol

SOD1 siRNA (Rat)

Sign In for Pricing
View Details
SOD1 siRNA (Rat)
orb1833620-02 30 nmol

SOD1 siRNA (Rat)

Sign In for Pricing
View Details