Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKN2 Peptide - C-terminal region

PKN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC150606, MGC71074, PAK2, PRK2, PRKCL2, PRO2042, Pak-2

UniProt

Q16513

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PKN2 Rabbit Polyclonal Antibody (orb585152) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006247

Preservative

Lyophilized powder

AA Sequence

TVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX8A (NM_004074) Human Tagged ORF Clone Lentiviral Particle
RC209065L1V 200 µL

COX8A (NM_004074) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human MBP Protein, N-His
orb2836768-01 20 µg

Recombinant Human MBP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MBP Protein, N-His
orb2836768-02 50 µg

Recombinant Human MBP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MBP Protein, N-His
orb2836768-03 100 µg

Recombinant Human MBP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human Small nuclear ribonucleoprotein Sm D2 Protein, GST, E.coli-200ug
QP8419-ec-200ug 200ug

Recombinant Human Small nuclear ribonucleoprotein Sm D2 Protein, GST, E.coli-200ug

Sign In for Pricing
View Details
MUC2 Antibody
orb389175-01 20 µg

MUC2 Antibody

Sign In for Pricing
View Details