Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKN2 Peptide - C-terminal region

PKN2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC150606, MGC71074, PAK2, PRK2, PRKCL2, PRO2042, Pak-2

UniProt

Q16513

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PKN2 Rabbit Polyclonal Antibody (orb585152) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006247

Preservative

Lyophilized powder

AA Sequence

TVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-C-heptyl-DNJ
HY-144124 1 Each

5-C-heptyl-DNJ

Sign In for Pricing
View Details
Mrpl38 (NM_024177) Mouse Untagged Clone
MC210207 10 µg

Mrpl38 (NM_024177) Mouse Untagged Clone

Sign In for Pricing
View Details
ARRDC1 Protein Vector (Human) (pPM-C-His)
PV002624 500 ng

ARRDC1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Exocyst complex component SEC3A (SEC3A) , partial
MBS1441009 Inquire

Recombinant Arabidopsis thaliana Exocyst complex component SEC3A (SEC3A) , partial

Sign In for Pricing
View Details
DREF (ZBED1) Human shRNA Lentiviral Particle (Locus ID 9189)
TL308318V 500 µL Each

DREF (ZBED1) Human shRNA Lentiviral Particle (Locus ID 9189)

Sign In for Pricing
View Details
Ammonium Chloride
02424-55 500 g

Ammonium Chloride

Sign In for Pricing
View Details