Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G2E Peptide - middle region

PLA2G2E Peptide - middle region

Product Specifications

UniProt

Q9NZK7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055404

Preservative

Lyophilized powder

AA Sequence

GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myeloperoxidase (MPO) Antibody (Biotin)
abx105689-01 20 µg

Myeloperoxidase (MPO) Antibody (Biotin)

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Antibody (Biotin)
abx105689-02 50 µg

Myeloperoxidase (MPO) Antibody (Biotin)

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Antibody (Biotin)
abx105689-03 100 µg

Myeloperoxidase (MPO) Antibody (Biotin)

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Antibody (Biotin)
abx105689-04 200 µg

Myeloperoxidase (MPO) Antibody (Biotin)

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Antibody (Biotin)
abx105689-05 1 mg

Myeloperoxidase (MPO) Antibody (Biotin)

Sign In for Pricing
View Details
ALDH3A2 Peptide - middle region (AAP44273)
AAP44273-100UG 100 µg

ALDH3A2 Peptide - middle region (AAP44273)

Sign In for Pricing
View Details