Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G4E Peptide - C-terminal region

PLA2G4E Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ45651, MGC126633, MGC126661

UniProt

C9JK77

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLA2G4E Rabbit Polyclonal Antibody (orb582115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073959

Preservative

Lyophilized powder

AA Sequence

TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP5S1 Protein Vector (Human) (pPB-His-MBP)
PV322626 500 ng

AP5S1 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Anti-RAB5C Antibody (R1Y17)
RHE80101 100 μg

Anti-RAB5C Antibody (R1Y17)

Sign In for Pricing
View Details
Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein
MBS9149054-01 0.01 mg

Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein

Sign In for Pricing
View Details
Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein
MBS9149054-02 0.02 mg

Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein

Sign In for Pricing
View Details
Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein
MBS9149054-03 0.05 mg

Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein

Sign In for Pricing
View Details
Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein
MBS9149054-04 0.1 mg

Recombinant Human TNFSF8/CD30 Ligand/CD153 Protein

Sign In for Pricing
View Details