Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLAT Peptide - middle region

PLAT Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686I03148, T-PA, TPA

UniProt

P00750

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLAT Rabbit Polyclonal Antibody (orb583669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_127509

Preservative

Lyophilized powder

AA Sequence

TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-LIMK1 (Thr508) + LIMK2 (Thr505) Rabbit Polyclonal Antibody (Cy5.5)
orb1048019 100 µL

Phospho-LIMK1 (Thr508) + LIMK2 (Thr505) Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Anti-Cathepsin A (CTSA)
FY-AB48552-01 1 mL

Anti-Cathepsin A (CTSA)

Sign In for Pricing
View Details
Anti-Cathepsin A (CTSA)
FY-AB48552-02 100 µL

Anti-Cathepsin A (CTSA)

Sign In for Pricing
View Details
Anti-Cathepsin A (CTSA)
FY-AB48552-03 200 µL

Anti-Cathepsin A (CTSA)

Sign In for Pricing
View Details
Mouse Anti Human Ikaros: RPE
MBS225824-01 100 Tests

Mouse Anti Human Ikaros: RPE

Sign In for Pricing
View Details
Mouse Anti Human Ikaros: RPE
MBS225824-02 5x 100 Tests

Mouse Anti Human Ikaros: RPE

Sign In for Pricing
View Details