Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHA1 Peptide - N-terminal region

PLEKHA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TAPP1

UniProt

Q9HB21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHA1 Rabbit Polyclonal Antibody (orb583606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067635

Preservative

Lyophilized powder

AA Sequence

LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-IFNAR2
YF-PA12600 100 ug

anti-IFNAR2

Sign In for Pricing
View Details
Collagen X Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-42277R-BF647 100 µL

Collagen X Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
EIF3I antibody
70R-17051 50 μL

EIF3I antibody

Sign In for Pricing
View Details
MUC7 Protein Lysate (Human) with C-Ha Tag
31142031 100 µg

MUC7 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
TTC27 Protein Lysate (Mouse) with C-HA Tag
48677034 100 µg

TTC27 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
N- (2,5-dimethylphenyl) -3- (3-methylphenyl) -2- (2H-tetrazol-5-yl) propanamide
sc-495163 5 mg

N- (2,5-dimethylphenyl) -3- (3-methylphenyl) -2- (2H-tetrazol-5-yl) propanamide

Sign In for Pricing
View Details