Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHA7 Peptide - middle region

PLEKHA7 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686M22243

UniProt

Q6IQ23

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHA7 Rabbit Polyclonal Antibody (orb582029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778228

Preservative

Lyophilized powder

AA Sequence

PESRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lin28 Recombinant Rabbit Monoclonal Antibody [JA10-63]
ET1704-26 100 µL

Lin28 Recombinant Rabbit Monoclonal Antibody [JA10-63]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS622362 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
DLX1 Human Gene Knockout Kit (CRISPR)
KN206895 1 Kit

DLX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SERPINA1 Polyclonal Antibody
E-AB-15449-01 20 µL

SERPINA1 Polyclonal Antibody

Sign In for Pricing
View Details
SERPINA1 Polyclonal Antibody
E-AB-15449-02 60 µL

SERPINA1 Polyclonal Antibody

Sign In for Pricing
View Details
SERPINA1 Polyclonal Antibody
E-AB-15449-03 120 µL

SERPINA1 Polyclonal Antibody

Sign In for Pricing
View Details