Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHG2 Peptide - middle region

PLEKHG2 Peptide - middle region

Product Specifications

Product Name Alternative

CLG, DKFZp667J2325, FLJ00018, FLJ22458, FLJ38638, ARHGEF42

UniProt

Q9H7P9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHG2 Rabbit Polyclonal Antibody (orb584403) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073746

Preservative

Lyophilized powder

AA Sequence

DLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQVLLENS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGA7 siRNA Oligos set (Human)
36171171 3x 5 nmol

PCDHGA7 siRNA Oligos set (Human)

Sign In for Pricing
View Details
ELISA Kit For Serine/threonine-protein kinase Chk1
E11379c 96 Tests

ELISA Kit For Serine/threonine-protein kinase Chk1

Sign In for Pricing
View Details
UBFD1 (NM_019116) Human Recombinant Protein
PROTO14562 20 µg

UBFD1 (NM_019116) Human Recombinant Protein

Sign In for Pricing
View Details
Phospho-c-Abl-Y204 Rabbit pAb
AP0003 200 µL

Phospho-c-Abl-Y204 Rabbit pAb

Sign In for Pricing
View Details
Zfp574 (NM_175477) Mouse Tagged ORF Clone
MG211099 10 µg

Zfp574 (NM_175477) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Rickettsia bellii Exodeoxyribonuclease 7 large subunit (xseA)
MBS1251989-01 0.02 mg (E-Coli)

Recombinant Rickettsia bellii Exodeoxyribonuclease 7 large subunit (xseA)

Sign In for Pricing
View Details