Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHG2 Peptide - middle region

PLEKHG2 Peptide - middle region

Product Specifications

Product Name Alternative

CLG, DKFZp667J2325, FLJ00018, FLJ22458, FLJ38638, ARHGEF42

UniProt

Q9H7P9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHG2 Rabbit Polyclonal Antibody (orb584403) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073746

Preservative

Lyophilized powder

AA Sequence

DLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQVLLENS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-C Motif Chemokine Ligand 13 (CCL13) Antibody
abx211314-01 50 µL

C-C Motif Chemokine Ligand 13 (CCL13) Antibody

Sign In for Pricing
View Details
C-C Motif Chemokine Ligand 13 (CCL13) Antibody
abx211314-02 100 µL

C-C Motif Chemokine Ligand 13 (CCL13) Antibody

Sign In for Pricing
View Details
CD200 Rabbit pAb
APA1503-01 30 µL

CD200 Rabbit pAb

Sign In for Pricing
View Details
CD200 Rabbit pAb
APA1503-02 50 μL

CD200 Rabbit pAb

Sign In for Pricing
View Details
CD200 Rabbit pAb
APA1503-03 100 µL

CD200 Rabbit pAb

Sign In for Pricing
View Details
Kv2.3 K+ channel/Kv8.1 Antibody
E55A14846 100 µg

Kv2.3 K+ channel/Kv8.1 Antibody

Sign In for Pricing
View Details