Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHJ1 Peptide - C-terminal region

PLEKHJ1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10297, GNRPX

UniProt

Q9NW61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHJ1 Rabbit Polyclonal Antibody (orb585430) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060519

Preservative

Lyophilized powder

AA Sequence

YHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sulfo-Cyanine7 tetrazine, 100 mg
653E0 100 mg

Sulfo-Cyanine7 tetrazine, 100 mg

Sign In for Pricing
View Details
Anti-Perilipin A (Rabbit, Monoclonal)
A118837 100 µL

Anti-Perilipin A (Rabbit, Monoclonal)

Sign In for Pricing
View Details
UBE2C AAV Vector (Human) (CMV)
48949101 1 µg

UBE2C AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
N-[ (2-Methylphenyl) methylidene]hydroxylamine
PAA68379-01 0.5 g

N-[ (2-Methylphenyl) methylidene]hydroxylamine

Sign In for Pricing
View Details
N-[ (2-Methylphenyl) methylidene]hydroxylamine
PAA68379-02 5 g

N-[ (2-Methylphenyl) methylidene]hydroxylamine

Sign In for Pricing
View Details
3- (Butyl-phenyl-sulfamoyl) -benzoic acid
sc-344534A 5 g

3- (Butyl-phenyl-sulfamoyl) -benzoic acid

Sign In for Pricing
View Details