Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLEKHJ1 Peptide - C-terminal region

PLEKHJ1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10297, GNRPX

UniProt

Q9NW61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLEKHJ1 Rabbit Polyclonal Antibody (orb585430) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060519

Preservative

Lyophilized powder

AA Sequence

YHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPM3 Rabbit Polyclonal Antibody
JOT-AP02297-01 20 µL

DPM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DPM3 Rabbit Polyclonal Antibody
JOT-AP02297-02 50 μL

DPM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DPM3 Rabbit Polyclonal Antibody
JOT-AP02297-03 100 µL

DPM3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Signal Transducer And Activator Of Transcription 6 ELISA kit
GTR10424332 96 Well

Mouse Signal Transducer And Activator Of Transcription 6 ELISA kit

Sign In for Pricing
View Details
GLIPR1L1 Polyclonal Antibody, Cy3 Conjugated
bs-13375R-Cy3 100 µL

GLIPR1L1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Activin Receptor Type IIB Polyclonal Antibody, Biotin Conjugated
bs-12417R-Biotin 100 µL

Activin Receptor Type IIB Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details