Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR1 Peptide - N-terminal region

PLSCR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MMTRA1B

UniProt

O15162

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLSCR1 Rabbit Polyclonal Antibody (orb583593) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066928

Preservative

Lyophilized powder

AA Sequence

MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PTEN MMAC1 TEP1 Protein (Sumo Tag)
PDEH100567-01 20 µg

Recombinant Human PTEN MMAC1 TEP1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human PTEN MMAC1 TEP1 Protein (Sumo Tag)
PDEH100567-02 100 µg

Recombinant Human PTEN MMAC1 TEP1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human PTEN MMAC1 TEP1 Protein (Sumo Tag)
PDEH100567-03 500 µg

Recombinant Human PTEN MMAC1 TEP1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human PTEN MMAC1 TEP1 Protein (Sumo Tag)
PDEH100567-04 1 mg

Recombinant Human PTEN MMAC1 TEP1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Cep192 Mouse Gene Knockout Kit (CRISPR)
KN503156 1 Kit

Cep192 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P53 Monoclonal Antibody
E-AB-22015-01 20 µL

P53 Monoclonal Antibody

Sign In for Pricing
View Details