PLSCR1 Peptide - N-terminal region
PLSCR1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MMTRA1B
UniProt
O15162
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLSCR1 Rabbit Polyclonal Antibody (orb583594) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066928
Preservative
Lyophilized powder
AA Sequence
MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040050-100 1x 100 µL
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470204-100 1x 100 µL
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402848-100 1x 100 µL
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details