Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plxdc2 Peptide - C-terminal region

Plxdc2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1200007L24Rik, 5430431D22Rik, AI646728, AU022916, AV231634, Tem7r

UniProt

Q9DC11

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Plxdc2 Rabbit Polyclonal Antibody (orb580985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080438

Preservative

Lyophilized powder

AA Sequence

HLKDSGASTDDSAAEKKGGTLHAGLIVGILILVLIIAAAILVTVYMYHHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIC3 Rabbit Polyclonal Antibody
E28PN7060 100 µL

RIC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
YBX1P5 Protein Vector (Human) (pPM-C-HA)
PV144020 500 ng

YBX1P5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Olivetol Dimethyl Ether-d9
018764 1 mg

Olivetol Dimethyl Ether-d9

Sign In for Pricing
View Details
Mouse Acylphosphatase 1 (ACYP1) ELISA Kit
GTR10314410 96 Well

Mouse Acylphosphatase 1 (ACYP1) ELISA Kit

Sign In for Pricing
View Details
C2CD4C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2750406 1.0 µg DNA

C2CD4C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PIP5K Cell-Based ELISA Kit
CB5559 1 Kit

PIP5K Cell-Based ELISA Kit

Sign In for Pricing
View Details