Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plxdc2 Peptide - C-terminal region

Plxdc2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1200007L24Rik, 5430431D22Rik, AI646728, AU022916, AV231634, Tem7r

UniProt

Q9DC11

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Plxdc2 Rabbit Polyclonal Antibody (orb580985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080438

Preservative

Lyophilized powder

AA Sequence

HLKDSGASTDDSAAEKKGGTLHAGLIVGILILVLIIAAAILVTVYMYHHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FhlA Antibody
orb815464 2 mg

FhlA Antibody

Sign In for Pricing
View Details
THAP11 Monoclonal Antibody
BT-MCA2838-01 50 µL

THAP11 Monoclonal Antibody

Sign In for Pricing
View Details
THAP11 Monoclonal Antibody
BT-MCA2838-02 100 µL

THAP11 Monoclonal Antibody

Sign In for Pricing
View Details
Karyopherin beta 3 Polyclonal Antibody, Biotin Conjugated
bs-17075R-Biotin 100 µL

Karyopherin beta 3 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Rat Monoclonal Caspase-11 Antibody (17D9)
NB120-10454SS 0.025 mL

Rat Monoclonal Caspase-11 Antibody (17D9)

Sign In for Pricing
View Details
Phospho-HER2 (Tyr1248) Antibody
E18-3069-2 100 µg -100 µL

Phospho-HER2 (Tyr1248) Antibody

Sign In for Pricing
View Details