Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pnck Peptide - C-terminal region

Pnck Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bstk3, CaMKIbeta2, CaMKlb2, Camk1b, Punc, caMKlb1

UniProt

Q9QYK9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pnck Rabbit Polyclonal Antibody (orb581474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036170

Preservative

Lyophilized powder

AA Sequence

KAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GREM1 / Gre mLin Reference Antibody (Regeneron anti-GREM1)
E24CHA440 100 µg

Anti-GREM1 / Gre mLin Reference Antibody (Regeneron anti-GREM1)

Sign In for Pricing
View Details
Human CNTF (NM_000614) AAV Particle
RC222331A1V 250 µL

Human CNTF (NM_000614) AAV Particle

Sign In for Pricing
View Details
Horse Tubulin Beta 1 ELISA Kit
MBS107690-01 48 Well

Horse Tubulin Beta 1 ELISA Kit

Sign In for Pricing
View Details
Horse Tubulin Beta 1 ELISA Kit
MBS107690-02 96 Well

Horse Tubulin Beta 1 ELISA Kit

Sign In for Pricing
View Details
Horse Tubulin Beta 1 ELISA Kit
MBS107690-03 5x 96 Well

Horse Tubulin Beta 1 ELISA Kit

Sign In for Pricing
View Details
Horse Tubulin Beta 1 ELISA Kit
MBS107690-04 10x 96 Well

Horse Tubulin Beta 1 ELISA Kit

Sign In for Pricing
View Details