Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pnck Peptide - C-terminal region

Pnck Peptide - C-terminal region

Product Specifications

Product Name Alternative

Bstk3, CaMKIbeta2, CaMKlb2, Camk1b, Punc, caMKlb1

UniProt

Q9QYK9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pnck Rabbit Polyclonal Antibody (orb581474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036170

Preservative

Lyophilized powder

AA Sequence

KAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adat3 (NM_001103361) Rat Tagged ORF Clone Lentiviral Particle
RR203644L3V 200 µL

Adat3 (NM_001103361) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human CD72 (Cluster Of Differentiation 72) Microsample ELISA Kit
ELK3443MS-01 48 Tests

Human CD72 (Cluster Of Differentiation 72) Microsample ELISA Kit

Sign In for Pricing
View Details
Human CD72 (Cluster Of Differentiation 72) Microsample ELISA Kit
ELK3443MS-02 96 Tests

Human CD72 (Cluster Of Differentiation 72) Microsample ELISA Kit

Sign In for Pricing
View Details
Human CD72 (Cluster Of Differentiation 72) Microsample ELISA Kit
ELK3443MS-03 5x 96 Tests

Human CD72 (Cluster Of Differentiation 72) Microsample ELISA Kit

Sign In for Pricing
View Details
TMEM119 (E3E4T) Mouse Monoclonal Antibody (BSA and Azide Free)
CST 83308SF 100 µg

TMEM119 (E3E4T) Mouse Monoclonal Antibody (BSA and Azide Free)

Sign In for Pricing
View Details
TRBV25OR9-2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV788456 1.0 µg DNA

TRBV25OR9-2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details