Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pnkd Peptide - N-terminal region

Pnkd Peptide - N-terminal region

Product Specifications

Product Name Alternative

2210013N15Rik, 2810403H05Rik, AI854243, Brp17, MNCb-5687, MR-1, Tahccp2

UniProt

Q69ZP3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pnkd Rabbit Polyclonal Antibody (orb579359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079856

Preservative

Lyophilized powder

AA Sequence

MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Fluoro-5- (trifluoromethyl) phenylethylamine
FF64401-01 100 mg

2-Fluoro-5- (trifluoromethyl) phenylethylamine

Sign In for Pricing
View Details
2-Fluoro-5- (trifluoromethyl) phenylethylamine
FF64401-02 250 mg

2-Fluoro-5- (trifluoromethyl) phenylethylamine

Sign In for Pricing
View Details
2-Fluoro-5- (trifluoromethyl) phenylethylamine
FF64401-03 500 mg

2-Fluoro-5- (trifluoromethyl) phenylethylamine

Sign In for Pricing
View Details
ELA-21 (Mouse) - I-125 Labeled
T-007-27 10 µCi

ELA-21 (Mouse) - I-125 Labeled

Sign In for Pricing
View Details
RHOT1 Rabbit pAb
MBS8545827-01 0.1 mL

RHOT1 Rabbit pAb

Sign In for Pricing
View Details
RHOT1 Rabbit pAb
MBS8545827-02 0.1 mL (AF405L)

RHOT1 Rabbit pAb

Sign In for Pricing
View Details