Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pnkd Peptide - N-terminal region

Pnkd Peptide - N-terminal region

Product Specifications

Product Name Alternative

2210013N15Rik, 2810403H05Rik, AI854243, Brp17, MNCb-5687, MR-1, Tahccp2

UniProt

Q69ZP3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pnkd Rabbit Polyclonal Antibody (orb579359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079856

Preservative

Lyophilized powder

AA Sequence

MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD32b/FCGR2B Mouse Monoclonal Antibody (FITC)
orb2973844-01 50 Tests

CD32b/FCGR2B Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
CD32b/FCGR2B Mouse Monoclonal Antibody (FITC)
orb2973844-02 100 Tests

CD32b/FCGR2B Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
Camk1 3'UTR GFP Stable Cell Line
TU153069 1.0 mL

Camk1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS708864 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
TFIIA-α and β-Like Factor (GTF2A1L) Human ELISA Kit
H5477 96 Tests

TFIIA-α and β-Like Factor (GTF2A1L) Human ELISA Kit

Sign In for Pricing
View Details
Homocystein
900142 100 mg

Homocystein

Sign In for Pricing
View Details