Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNKP Peptide - N-terminal region

PNKP Peptide - N-terminal region

Product Specifications

Product Name Alternative

PNK, MCSZ, EIEE10

UniProt

Q96T60

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PNKP Rabbit Polyclonal Antibody (orb581662) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009185

Preservative

Lyophilized powder

AA Sequence

MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog IL5/Interleukin-5 ELISA Kit
E0062Do 96 Tests

Dog IL5/Interleukin-5 ELISA Kit

Sign In for Pricing
View Details
Sestrin-3, ID (Y335) (SESN3, SEST3, Sestrin-3)
MBS649534-01 0.2 mL

Sestrin-3, ID (Y335) (SESN3, SEST3, Sestrin-3)

Sign In for Pricing
View Details
Sestrin-3, ID (Y335) (SESN3, SEST3, Sestrin-3)
MBS649534-02 5x 0.2 mL

Sestrin-3, ID (Y335) (SESN3, SEST3, Sestrin-3)

Sign In for Pricing
View Details
Recombinant Chlorobium chlorochromatii Protein TolB (tolB)
MBS1357241-01 0.02 mg (E-Coli)

Recombinant Chlorobium chlorochromatii Protein TolB (tolB)

Sign In for Pricing
View Details
Recombinant Chlorobium chlorochromatii Protein TolB (tolB)
MBS1357241-02 0.02 mg (Yeast)

Recombinant Chlorobium chlorochromatii Protein TolB (tolB)

Sign In for Pricing
View Details
Recombinant Chlorobium chlorochromatii Protein TolB (tolB)
MBS1357241-03 0.1 mg (E-Coli)

Recombinant Chlorobium chlorochromatii Protein TolB (tolB)

Sign In for Pricing
View Details