Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNO1 Peptide - N-terminal region

PNO1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KHRBP1, RRP20

UniProt

B4DLZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PNO1 Rabbit Polyclonal Antibody (orb585376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001193997

Preservative

Lyophilized powder

AA Sequence

QAEQLSAAGEGGDAGRMDTEEARPAKRPVFPPLCGDGLLSGKEETRKIPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Adenylate cyclase type 6 (ADCY6) ELISA kit
GTR10447531 96 Well

Porcine Adenylate cyclase type 6 (ADCY6) ELISA kit

Sign In for Pricing
View Details
TipOne 300 uL graduated pipette tips in racks, sterile, 80 racks of 96 tips (7680 tips)
1110-9880 7680 Tips

TipOne 300 uL graduated pipette tips in racks, sterile, 80 racks of 96 tips (7680 tips)

Sign In for Pricing
View Details
Desmoglein 1 Recombinant Antibody, PE Conjugated
bsm-54326R-PE-01 20 µL

Desmoglein 1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Desmoglein 1 Recombinant Antibody, PE Conjugated
bsm-54326R-PE-02 100 µL

Desmoglein 1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
LIM Homeobox 2 (LH2, hLhx2, LHX2)
L2198-75 100 µg

LIM Homeobox 2 (LH2, hLhx2, LHX2)

Sign In for Pricing
View Details
TIE2 (TEK) Mouse Monoclonal Antibody [Clone ID: Cl.16]
DM3511B 50 µg

TIE2 (TEK) Mouse Monoclonal Antibody [Clone ID: Cl.16]

Sign In for Pricing
View Details