Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNO1 Peptide - N-terminal region

PNO1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KHRBP1, RRP20

UniProt

B4DLZ8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PNO1 Rabbit Polyclonal Antibody (orb585376) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001193997

Preservative

Lyophilized powder

AA Sequence

QAEQLSAAGEGGDAGRMDTEEARPAKRPVFPPLCGDGLLSGKEETRKIPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal pan Actin Antibody (HHF35) [Alexa Fluor 750]
NBP2-34634AF750 0.1 mL

Mouse Monoclonal pan Actin Antibody (HHF35) [Alexa Fluor 750]

Sign In for Pricing
View Details
5- (7-Chloro-1,3-dioxaindan-5-yl) -1- (propan-2-yl) imidazolidin-2-imine hydrobromide
DXC56130-01 50 mg

5- (7-Chloro-1,3-dioxaindan-5-yl) -1- (propan-2-yl) imidazolidin-2-imine hydrobromide

Sign In for Pricing
View Details
5- (7-Chloro-1,3-dioxaindan-5-yl) -1- (propan-2-yl) imidazolidin-2-imine hydrobromide
DXC56130-02 0.5 g

5- (7-Chloro-1,3-dioxaindan-5-yl) -1- (propan-2-yl) imidazolidin-2-imine hydrobromide

Sign In for Pricing
View Details
SERINC3 Protein Vector (Human) (pPB-N-His)
PV037486 500 ng

SERINC3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
C-C motif chemokine 16
308355-01 50 µg

C-C motif chemokine 16

Sign In for Pricing
View Details
C-C motif chemokine 16
308355-02 100 µg

C-C motif chemokine 16

Sign In for Pricing
View Details