Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNRC1 Peptide - middle region

PNRC1 Peptide - middle region

Product Specifications

Product Name Alternative

B4-2, PNAS-145, PROL2, PRR2, RP11-63L7.5

UniProt

Q12796

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PNRC1 Rabbit Polyclonal Antibody (orb325725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006804

Preservative

Lyophilized powder

AA Sequence

KEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha Sarcoglycan (SGCA) CytoSection
TS406577P5 25 Slides

alpha Sarcoglycan (SGCA) CytoSection

Sign In for Pricing
View Details
{1H,2H,3H,4H,9H-Pyrido[3,4-b]indol-3-yl}methanol
ABA67471-01 50 mg

{1H,2H,3H,4H,9H-Pyrido[3,4-b]indol-3-yl}methanol

Sign In for Pricing
View Details
{1H,2H,3H,4H,9H-Pyrido[3,4-b]indol-3-yl}methanol
ABA67471-02 0.5 g

{1H,2H,3H,4H,9H-Pyrido[3,4-b]indol-3-yl}methanol

Sign In for Pricing
View Details
TEDDM1 Protein Vector (Mouse) (pPM-C-His)
PV237525 500 ng

TEDDM1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Factor VIII
F0016-02 100 µg

Factor VIII

Sign In for Pricing
View Details
LASS3 (LAG1 Homolog, Ceramide Synthase 3, CerS3, MGC27091) (HRP)
MBS6183473-01 0.1 mL

LASS3 (LAG1 Homolog, Ceramide Synthase 3, CerS3, MGC27091) (HRP)

Sign In for Pricing
View Details