Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNRC1 Peptide - middle region

PNRC1 Peptide - middle region

Product Specifications

Product Name Alternative

B4-2, PNAS-145, PROL2, PRR2, RP11-63L7.5

UniProt

Q12796

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PNRC1 Rabbit Polyclonal Antibody (orb325725) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006804

Preservative

Lyophilized powder

AA Sequence

KEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MMP20 Antibody
NBP3-04391-100ul 100 µL

Rabbit Polyclonal MMP20 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Sorbs2 shRNA (UAS) - Lentiviral mouse Sorbs2 shRNA (UAS, iRFP) plasmid
GTR15278764 1 Vial

Lentiviral mouse Sorbs2 shRNA (UAS) - Lentiviral mouse Sorbs2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
RPL31P36 3'UTR Lenti-reporter-Luc Vector
41377081 1.0 µg

RPL31P36 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Anti-Hu CD48 FITC
MBS1800993-01 100 Tests

Anti-Hu CD48 FITC

Sign In for Pricing
View Details
Anti-Hu CD48 FITC
MBS1800993-02 5x 100 Tests

Anti-Hu CD48 FITC

Sign In for Pricing
View Details
Human insulin-like growth factors binding protein 3, IGFBP-3 ELISA Kit
NB-E10157 96 Well

Human insulin-like growth factors binding protein 3, IGFBP-3 ELISA Kit

Sign In for Pricing
View Details