Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pnrc2 Peptide - N-terminal region

Pnrc2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC93828, Pnrc2

UniProt

Q66HE1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pnrc2 Rabbit Polyclonal Antibody (orb583416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001096830

Preservative

Lyophilized powder

AA Sequence

MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2H4P Protein Vector (Human) (pPM-C-His)
PV106577 500 ng

OR2H4P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
C4orf44 Polyclonal Antibody, Cy3 Conjugated
bs-9998R-Cy3 100 µL

C4orf44 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
PCDHB5, ID (PCDHB5, Protocadherin beta-5) (MaxLight 650) discontinued
039748-ML650 100 µL

PCDHB5, ID (PCDHB5, Protocadherin beta-5) (MaxLight 650) discontinued

Sign In for Pricing
View Details
RPL17P35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1915808 1.0 µg DNA

RPL17P35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ZFP106 Rabbit Polyclonal Antibody
orb215264-01 30 µL

ZFP106 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZFP106 Rabbit Polyclonal Antibody
orb215264-02 50 μL

ZFP106 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details