Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pnrc2 Peptide - N-terminal region

Pnrc2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC93828, Pnrc2

UniProt

Q66HE1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pnrc2 Rabbit Polyclonal Antibody (orb583416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001096830

Preservative

Lyophilized powder

AA Sequence

MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNK2-IN-1
HY-145111 1 Each

TNK2-IN-1

Sign In for Pricing
View Details
Mouse Netrin-G2, NTNG2 ELISA Kit
MBS9318107-01 48 Well

Mouse Netrin-G2, NTNG2 ELISA Kit

Sign In for Pricing
View Details
Mouse Netrin-G2, NTNG2 ELISA Kit
MBS9318107-02 96 Well

Mouse Netrin-G2, NTNG2 ELISA Kit

Sign In for Pricing
View Details
Mouse Netrin-G2, NTNG2 ELISA Kit
MBS9318107-03 5x 96 Well

Mouse Netrin-G2, NTNG2 ELISA Kit

Sign In for Pricing
View Details
Mouse Netrin-G2, NTNG2 ELISA Kit
MBS9318107-04 10x 96 Well

Mouse Netrin-G2, NTNG2 ELISA Kit

Sign In for Pricing
View Details
Etos1 Mouse siRNA Oligo Duplex (Locus ID 114660)
SR403090 1 Kit

Etos1 Mouse siRNA Oligo Duplex (Locus ID 114660)

Sign In for Pricing
View Details