Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNRC2 Peptide - middle region

PNRC2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20312, MGC99541

UniProt

Q9NPJ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PNRC2 Rabbit Polyclonal Antibody (orb583417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060231

Preservative

Lyophilized powder

AA Sequence

NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARPC3P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV757520 1.0 µg DNA

ARPC3P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ATF6B Adenovirus (Mouse)
12617054 1.0 mL

ATF6B Adenovirus (Mouse)

Sign In for Pricing
View Details
Rabbit anti-AMPK beta 2 Antibody
DL97044A-01 50 µL

Rabbit anti-AMPK beta 2 Antibody

Sign In for Pricing
View Details
Rabbit anti-AMPK beta 2 Antibody
DL97044A-02 100 µL

Rabbit anti-AMPK beta 2 Antibody

Sign In for Pricing
View Details
SMAP1, NT (SMAP1, Stromal membrane-associated protein 1)
042030 200 µL

SMAP1, NT (SMAP1, Stromal membrane-associated protein 1)

Sign In for Pricing
View Details
LGALS1 Adenovirus (Rat)
26460056 1.0 mL

LGALS1 Adenovirus (Rat)

Sign In for Pricing
View Details