Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PODXL2 Peptide - N-terminal region

PODXL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PODLX2

UniProt

Q9NZ53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PODXL2 Rabbit Polyclonal Antibody (orb579977) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056535

Preservative

Lyophilized powder

AA Sequence

EEEELNDSSLDLGPTADYVFPDLTEKAGSIEDTSQAQELPNLPSPLPKMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PCDHGA11 activation kit by CRISPRa
GA111103 1 Kit

Human PCDHGA11 activation kit by CRISPRa

Sign In for Pricing
View Details
TOR1AIP1 antibody
FNab08871 100 µg

TOR1AIP1 antibody

Sign In for Pricing
View Details
2-(2,6-Dioxo-3-hydroxypiperidin-5-yl)-4-aminoisoindoline-1,3-dione
TRC-D893455-5MG 5 mg

2-(2,6-Dioxo-3-hydroxypiperidin-5-yl)-4-aminoisoindoline-1,3-dione

Sign In for Pricing
View Details
Recombinant IGFBP2 Antibody
RC-4984-01 50 μL

Recombinant IGFBP2 Antibody

Sign In for Pricing
View Details
Recombinant IGFBP2 Antibody
RC-4984-02 100 µL

Recombinant IGFBP2 Antibody

Sign In for Pricing
View Details
Recombinant IGFBP2 Antibody
RC-4984-03 1 mL

Recombinant IGFBP2 Antibody

Sign In for Pricing
View Details