Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PODXL2 Peptide - N-terminal region

PODXL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PODLX2

UniProt

Q9NZ53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PODXL2 Rabbit Polyclonal Antibody (orb579977) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056535

Preservative

Lyophilized powder

AA Sequence

EEEELNDSSLDLGPTADYVFPDLTEKAGSIEDTSQAQELPNLPSPLPKMN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS501740 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
H-PHE-PHE-OH
TRC-P399245-2.5G 2.5 g

H-PHE-PHE-OH

Sign In for Pricing
View Details
Tuba4a Mouse Gene Knockout Kit (CRISPR)
KN518463 1 Kit

Tuba4a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLC β3 (Ab-537) Antibody
8B0722-AAT 50 µg

PLC β3 (Ab-537) Antibody

Sign In for Pricing
View Details
Tsc22d4 Mouse Gene Knockout Kit (CRISPR)
KN518325 1 Kit

Tsc22d4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ASRGL1 activation kit by CRISPRa
GA112839 1 Kit

Human ASRGL1 activation kit by CRISPRa

Sign In for Pricing
View Details