POFUT1 Peptide - middle region
POFUT1 Peptide - middle region
Product Specifications
Product Name Alternative
FUT12, KIAA0180, MGC2482, O-FUT, O-Fuc-T, O-FucT-1
UniProt
Q6EV69
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POFUT1 Rabbit Polyclonal Antibody (orb584334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_056167
Preservative
Lyophilized powder
AA Sequence
RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-61492R-HRP-01 20 µL
Drosha Recombinant Antibody, HRP Conjugated
Sign In for Pricing
View Details bsm-61492R-HRP-02 100 µL
Drosha Recombinant Antibody, HRP Conjugated
Sign In for Pricing
View Details GTR15105868 1 Vial
Lentiviral human SLC7A1 shRNA (UAS) - Lentiviral human SLC7A1 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details 
OKAG00610 96 Well
c-Jun Colorimetric Cell-Based ELISA Kit (OKAG00610)
Sign In for Pricing
View Details 
TRV-0011026-01 10 µg
Recombinant Parathyroid Hormone Related Protein (PTHrP)
Sign In for Pricing
View Details