Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POGZ Peptide - C-terminal region

POGZ Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0461, MGC71543, SUHW5, ZNF280E, ZNF635, ZNF635m

UniProt

Q7Z3K3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POGZ Rabbit Polyclonal Antibody (orb576990) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055915

Preservative

Lyophilized powder

AA Sequence

ASLEEQLKLSGEHSESSTPRPRSSPEETIEPESLHQLFEGESETESFYGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Serum - 500ml
GU-310/500 500 mL

Guinea Pig Serum - 500ml

Sign In for Pricing
View Details
Human SLC25A14 (NM_001282195) AAV Particle
RC237453A1V 250 µL

Human SLC25A14 (NM_001282195) AAV Particle

Sign In for Pricing
View Details
COMMD1 Antibody - C-terminal region : FITC (ARP61706_P050-FITC)
ARP61706_P050-FITC 100 µL

COMMD1 Antibody - C-terminal region : FITC (ARP61706_P050-FITC)

Sign In for Pricing
View Details
KCNK1 (NM_002245) Human 3' UTR Clone
SC211552 10 µg

KCNK1 (NM_002245) Human 3' UTR Clone

Sign In for Pricing
View Details
RAB36, CT (RAB36, Ras-related protein Rab-36)
MBS641920-01 0.2 mL

RAB36, CT (RAB36, Ras-related protein Rab-36)

Sign In for Pricing
View Details
RAB36, CT (RAB36, Ras-related protein Rab-36)
MBS641920-02 5x 0.2 mL

RAB36, CT (RAB36, Ras-related protein Rab-36)

Sign In for Pricing
View Details