POLD3 Peptide - C-terminal region
POLD3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
KIAA0039, MGC119642, MGC119643, P66, P68
UniProt
Q15054
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POLD3 Rabbit Polyclonal Antibody (orb585218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006582
Preservative
Lyophilized powder
AA Sequence
EEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA725040 100 µL
Mouse CCL2 / MCP-1 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details ![p57 Kip2 (CDKN1C) Mouse Monoclonal Antibody [Clone ID: KP10]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc5e2/imageurl/am10128su-n.webp)
AM10128SU-N 1 mL
p57 Kip2 (CDKN1C) Mouse Monoclonal Antibody [Clone ID: KP10]
Sign In for Pricing
View Details 
RG236058 10 µg
C1orf86 (FAAP20) (NM_001282672) Human Tagged ORF Clone
Sign In for Pricing
View Details 
BNUB0945-500 1x 500 µL
Double Stranded DNA (dsDNA) (121-3), 0.2mg/mL
Sign In for Pricing
View Details 
