POLD3 Peptide - C-terminal region
POLD3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
KIAA0039, MGC119642, MGC119643, P66, P68
UniProt
Q15054
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POLD3 Rabbit Polyclonal Antibody (orb585218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006582
Preservative
Lyophilized powder
AA Sequence
EEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA397653 1 mg
Goat IgG (H&L) Antibody Alkaline Phosphatase Conjugated
Sign In for Pricing
View Details 
BNC403082-100 1x 100 µL
Cathepsin D (Tumor Marker) (CTSD/3082), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![ABAT Mouse Monoclonal Antibody [Clone ID: OTI3D2]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907f92/imageurl/cf806896.webp)
E-EL-H0185-01 24 Tests
Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
Sign In for Pricing
View Details