Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Polg Peptide - N-terminal region

Polg Peptide - N-terminal region

Product Specifications

UniProt

Q9QYV8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Polg Rabbit Polyclonal Antibody (orb580457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_445980

Preservative

Lyophilized powder

AA Sequence

QDWQEQLVVGHNVSFDRAHIREQYLIQGSRMHFLDTMSMHMAISGLSSFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COMMD1 Human Gene Knockout Kit (CRISPR)
KN205614 1 Kit

COMMD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), CF640R conjugate, 0.1mg/mL
BNC402058-500 1x 500 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Leukotriene A4 Hydrolase Monoclonal Antibody
E-AB-81478-01 50 µL

Recombinant Leukotriene A4 Hydrolase Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Leukotriene A4 Hydrolase Monoclonal Antibody
E-AB-81478-02 100 µL

Recombinant Leukotriene A4 Hydrolase Monoclonal Antibody

Sign In for Pricing
View Details
SR 9009
TRC-S684255-5MG 5 mg

SR 9009

Sign In for Pricing
View Details
Human TAGAP activation kit by CRISPRa
GA114645 1 Kit

Human TAGAP activation kit by CRISPRa

Sign In for Pricing
View Details