Polg Peptide - N-terminal region
Polg Peptide - N-terminal region
Product Specifications
UniProt
Q9QYV8
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Polg Rabbit Polyclonal Antibody (orb580457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_445980
Preservative
Lyophilized powder
AA Sequence
QDWQEQLVVGHNVSFDRAHIREQYLIQGSRMHFLDTMSMHMAISGLSSFQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![GATA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D5]](https://cdn.genprice.uk/products/937/68dd1b81061270361ea1ea0c/imageurl/ta809143am.webp)
TA809143AM 100 µL
GATA3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D5]
Sign In for Pricing
View Details 
![Synaptophysin (SYP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]](https://cdn.genprice.uk/products/937/6868c368994c49e6dc3f6c05/imageurl/ta506067bm.webp)
TA506067BM 100 µL
Synaptophysin (SYP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]
Sign In for Pricing
View Details ![DTWD1 Mouse Monoclonal Antibody [Clone ID: OTI1D2]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908ddb/imageurl/cf811576.webp)
