POLR1B Peptide - middle region
POLR1B Peptide - middle region
Product Specifications
Product Name Alternative
FLJ10816, FLJ21921, MGC131780, RPA135, Rpo1-2, RPA2
UniProt
Q9H9Y6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POLR1B Rabbit Polyclonal Antibody (orb580544) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_061887
Preservative
Lyophilized powder
AA Sequence
SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PARK7 (1-187) Mouse Monoclonal Antibody [Clone ID: 3E8]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fccf7/imageurl/am26596af-n.webp)
AM26596AF-N 100 µg
PARK7 (1-187) Mouse Monoclonal Antibody [Clone ID: 3E8]
Sign In for Pricing
View Details 
AP01883PU-N 100 µg
VEGF Receptor 1 (FLT1) pTyr1333 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC403179-100 1x 100 µL
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3179), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details