Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3C Peptide - middle region

POLR3C Peptide - middle region

Product Specifications

Product Name Alternative

RPC3, RPC62

UniProt

Q9BUI4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLR3C Rabbit Polyclonal Antibody (orb581606) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006459

Preservative

Lyophilized powder

AA Sequence

VEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pre-rRNA-Processing Protein TSR2 (TSR2) Antibody (Biotin)
abx317524-01 20 µg

Pre-rRNA-Processing Protein TSR2 (TSR2) Antibody (Biotin)

Sign In for Pricing
View Details
Pre-rRNA-Processing Protein TSR2 (TSR2) Antibody (Biotin)
abx317524-02 50 µg

Pre-rRNA-Processing Protein TSR2 (TSR2) Antibody (Biotin)

Sign In for Pricing
View Details
Pre-rRNA-Processing Protein TSR2 (TSR2) Antibody (Biotin)
abx317524-03 100 µg

Pre-rRNA-Processing Protein TSR2 (TSR2) Antibody (Biotin)

Sign In for Pricing
View Details
Pre-rRNA-Processing Protein TSR2 (TSR2) Antibody (Biotin)
abx317524-04 200 µg

Pre-rRNA-Processing Protein TSR2 (TSR2) Antibody (Biotin)

Sign In for Pricing
View Details
Pre-rRNA-Processing Protein TSR2 (TSR2) Antibody (Biotin)
abx317524-05 1 mg

Pre-rRNA-Processing Protein TSR2 (TSR2) Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit Anti-RDX monoclonal antibody, clone TD17-25
CABT-L698 100 ul

Rabbit Anti-RDX monoclonal antibody, clone TD17-25

Sign In for Pricing
View Details