Pomgnt1 Peptide - N-terminal region
Pomgnt1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
0610016I07Rik, 4930467B06Rik, RP23-319H15.3
UniProt
Q91X88
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pomgnt1 Rabbit Polyclonal Antibody (orb330568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080927
Preservative
Lyophilized powder
AA Sequence
LLVTVIVNIKLILDTRRAISEANEDPEPEQDYDEALGRLESPRRRGSSPR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470050-500 1x 500 µL
IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041037-500 1x 500 µL
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401231-100 1x 100 µL
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details