POP5 Peptide - middle region
POP5 Peptide - middle region
Product Specifications
Product Name Alternative
HSPC004, RPP2, RPP20, hPop5
UniProt
Q969H6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POP5 Rabbit Polyclonal Antibody (orb326122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057002
Preservative
Lyophilized powder
AA Sequence
KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681967-500 1x 500 µL
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882332-100 1x 100 µL
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RD-NKRF-Hu-01 96 Tests
Human NFKB Repressing Factor (NKRF) ELISA Kit
Sign In for Pricing
View Details RD-NKRF-Hu-02 48 Tests
Human NFKB Repressing Factor (NKRF) ELISA Kit
Sign In for Pricing
View Details