Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POP5 Peptide - middle region

POP5 Peptide - middle region

Product Specifications

Product Name Alternative

HSPC004, RPP2, RPP20, hPop5

UniProt

Q969H6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POP5 Rabbit Polyclonal Antibody (orb326122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057002

Preservative

Lyophilized powder

AA Sequence

KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GTPase HRAS, C-His Tag
HA211122-01 20 µg

Human GTPase HRAS, C-His Tag

Sign In for Pricing
View Details
Human GTPase HRAS, C-His Tag
HA211122-02 50 µg

Human GTPase HRAS, C-His Tag

Sign In for Pricing
View Details
Human GTPase HRAS, C-His Tag
HA211122-03 100 µg

Human GTPase HRAS, C-His Tag

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS505057 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Kras Mouse Gene Knockout Kit (CRISPR)
KN308968RB 1 Kit

Kras Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MEPE activation kit by CRISPRa
GA111301 1 Kit

Human MEPE activation kit by CRISPRa

Sign In for Pricing
View Details