Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POT1 Peptide - middle region

POT1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZP586D211, hPot1, HPOT1

UniProt

Q9NUX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POT1 Rabbit Polyclonal Antibody (orb583953) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056265

Preservative

Lyophilized powder

AA Sequence

MNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Svop Mouse Gene Knockout Kit (CRISPR)
KN517019 1 Kit

Svop Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4'-Isobutyl-2,2-dibromopropiophenone
TRC-I780400-25MG 25 mg

4'-Isobutyl-2,2-dibromopropiophenone

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS506261 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Human IL20RB activation kit by CRISPRa
GA110030 1 Kit

Human IL20RB activation kit by CRISPRa

Sign In for Pricing
View Details
Human CDC2L6 (CDK19) activation kit by CRISPRa
GA108036 1 Kit

Human CDC2L6 (CDK19) activation kit by CRISPRa

Sign In for Pricing
View Details
Tyrosine Hydroxylase (TH) pSer19 Rabbit Polyclonal Antibody
AP09482PU-N 100 µL

Tyrosine Hydroxylase (TH) pSer19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details