Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POT1 Peptide - middle region

POT1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZP586D211, hPot1, HPOT1

UniProt

Q9NUX5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POT1 Rabbit Polyclonal Antibody (orb583953) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056265

Preservative

Lyophilized powder

AA Sequence

MNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIZ1 (PRDM2) Rabbit Polyclonal Antibody
TA371404 100 µL

RIZ1 (PRDM2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD43 (SPN/1094), CF405S conjugate, 0.1mg/mL
BNC041094-100 1x 100 µL

CD43 (SPN/1094), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human B Raf (BRAF) ELISA Kit 1 x 96
EA200054 96 Well

Human B Raf (BRAF) ELISA Kit 1 x 96

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS520006 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Human POU5F1B activation kit by CRISPRa
GA103683 1 Kit

Human POU5F1B activation kit by CRISPRa

Sign In for Pricing
View Details
VEGF Receptor 2 (KDR) pTyr951 Rabbit Polyclonal Antibody
AP02384PU-N 100 µL

VEGF Receptor 2 (KDR) pTyr951 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details