POT1 Peptide - middle region
POT1 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZP586D211, hPot1, HPOT1
UniProt
Q9NUX5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POT1 Rabbit Polyclonal Antibody (orb583954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001036059
Preservative
Lyophilized powder
AA Sequence
CPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYDSKIWTTKNQKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-CL-H0935-01 24 Tests
Human MMP-8 (Matrix Metalloproteinase 8) CLIA Kit
Sign In for Pricing
View Details E-CL-H0935-02 48 Tests
Human MMP-8 (Matrix Metalloproteinase 8) CLIA Kit
Sign In for Pricing
View Details E-CL-H0935-03 96 Tests
Human MMP-8 (Matrix Metalloproteinase 8) CLIA Kit
Sign In for Pricing
View Details 