Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou3f1 Peptide - N-terminal region

Pou3f1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Oct-6, Otf6, Scip, Test1, Tst-1, Tst1, Oct6

UniProt

P21952

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pou3f1 Rabbit Polyclonal Antibody (orb583846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035271

Preservative

Lyophilized powder

AA Sequence

QYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCKR (NM_001486) Human Over-expression Lysate
LY400576 100 µg

GCKR (NM_001486) Human Over-expression Lysate

Sign In for Pricing
View Details
WDR13 (NM_001166426) Human Over-expression Lysate
LY432987 100 µg

WDR13 (NM_001166426) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Atp2b1 activation kit by CRISPRa
GA207617 1 Kit

Mouse Atp2b1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD14 Rabbit Monoclonal Antibody
TA422662 100 µL

CD14 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF514 Conjugate, 0.1 mg/mL
BNC511331-1ML 1x 1 mL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF514 Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR561371 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details