Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou3f1 Peptide - N-terminal region

Pou3f1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Oct-6, Otf6, Scip, Test1, Tst-1, Tst1, Oct6

UniProt

P21952

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pou3f1 Rabbit Polyclonal Antibody (orb583846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035271

Preservative

Lyophilized powder

AA Sequence

QYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGL3 (NM_001035223) Human Over-expression Lysate
LY422124 100 µg

RGL3 (NM_001035223) Human Over-expression Lysate

Sign In for Pricing
View Details
CF®568 Maleimide
#92024 1x 1 µmol

CF®568 Maleimide

Sign In for Pricing
View Details
Repirinast-d4
TRC-R144562-5MG 5 mg

Repirinast-d4

Sign In for Pricing
View Details
Nuclear Green™ DCS1 *5 mM DMSO Solution*
17550-AAT 0.5 mL

Nuclear Green™ DCS1 *5 mM DMSO Solution*

Sign In for Pricing
View Details
S-(2-Aminoethyl)-l-cysteine, hydrochloride
TRC-A608055-250MG 250 mg

S-(2-Aminoethyl)-l-cysteine, hydrochloride

Sign In for Pricing
View Details
Dehydro Cyclosporin A (~90%)
TRC-D230190-5MG 5 mg

Dehydro Cyclosporin A (~90%)

Sign In for Pricing
View Details