Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou4f3 Peptide - N-terminal region

Pou4f3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Brn3.1, Brn3c, ddl, dreidel

UniProt

Q63955

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pou4f3 Rabbit Polyclonal Antibody (orb329703) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620395

Preservative

Lyophilized powder

AA Sequence

PKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUNDC1 siRNA (r)
sc-270532 10 µM

FUNDC1 siRNA (r)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 anti-mouse CD79b (Igβ)
GT03694 100 µg

PerCP/Cyanine5.5 anti-mouse CD79b (Igβ)

Sign In for Pricing
View Details
Lentiviral mouse Zc2hc1c shRNA (UAS) - Lentiviral mouse Zc2hc1c shRNA (UAS, iRFP) (25)
GTR15300449 1 Vial

Lentiviral mouse Zc2hc1c shRNA (UAS) - Lentiviral mouse Zc2hc1c shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human VEGFR-3/FLT-4, soluble
MBS692181-01 0.005 mg

Human VEGFR-3/FLT-4, soluble

Sign In for Pricing
View Details
Human VEGFR-3/FLT-4, soluble
MBS692181-02 5x 0.005 mg

Human VEGFR-3/FLT-4, soluble

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Protein YOP1 (YOP1)
orb2919126-01 20 µg

Recombinant Ashbya gossypii Protein YOP1 (YOP1)

Sign In for Pricing
View Details